PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G2035
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 505aa    MW: 56828 Da    PI: 5.6933
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G2035genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-17255301148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ed  l ++v+++G++ W+ Ia++++ gR +kqc++rw+++l
      Gh_A07G2035 255 KGQWTPQEDRVLMQLVTRHGTKKWSQIAKMLN-GRVGKQCRERWHNHL 301
                      799*****************************.*************97 PP

2Myb_DNA-binding53.36.5e-17307349145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eEd +l+ a+k+ G++ W+ Ia++++ gRt++ +k++w+
      Gh_A07G2035 307 KDSWSEEEDMILIAAHKEIGNK-WAEIAKRLP-GRTENTIKNHWN 349
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.223250305IPR017930Myb domain
SuperFamilySSF466894.31E-31253348IPR009057Homeodomain-like
SMARTSM007171.3E-14254303IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-28256308IPR009057Homeodomain-like
CDDcd001671.60E-13258301No hitNo description
PfamPF139214.1E-19258315No hitNo description
PROSITE profilePS5129419.825306356IPR017930Myb domain
SMARTSM007172.4E-16306354IPR001005SANT/Myb domain
CDDcd001671.62E-12309352No hitNo description
Gene3DG3DSA:1.10.10.604.5E-22309354IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MEYDTSFKED FPFLSSLFSE NNSNSSFKPD FNGCFPLPDG SSPSSSSSPS SSSSKALVHN  60
FILNQDQDTT PTGNNNNGSF LNNHTHHFHQ FPIDGSSKNP FFEDSTTCTD PFIDPYTNDL  120
NAYIPSLSFT VPDHGTSLNN GLTFQAFSTE SPCWDFSQNK ASAPPEAGDH HRSYQQQQQE  180
PMDFQDQPPT PPPPPPPVAT KVAEDASCIT NQNGRNNNNQ DRDDDDDDDE KNNNNRRFLK  240
AKRVNQATKK NSIIKGQWTP QEDRVLMQLV TRHGTKKWSQ IAKMLNGRVG KQCRERWHNH  300
LRPDIKKDSW SEEEDMILIA AHKEIGNKWA EIAKRLPGRT ENTIKNHWNA TKRRQFTRRS  360
KAKDGNSNPP KGSLLQNYIK SVSSPTELTP AAAASSSSQH ENEFEMTDAN PHMVQLETSS  420
LNSTGWSIGD LNDHVQRQRQ QQQEVNYCFD ANVYNDIHRN QSFGSMLEGD GNGNGSGMGN  480
FELPLEMDSL KKELDLLEMI SQGNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-452533552104C-Myb DNA-Binding Domain
1msf_C5e-452533552104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00385DAPTransfer from AT3G27785Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6154680.0JX615468.1 Gossypium hirsutum clone NBRI_GE59465 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444519.10.0PREDICTED: myb-like protein AA
TrEMBLA0A0D2NEN80.0A0A0D2NEN8_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.12e-72myb domain protein 118